(data stored in ACNUC29543 zone)

EMBL: CP001044.PE447

CP001044.PE447       Location/Qualifiers
FT   CDS             521338..521745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3577"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   bxe:Bxe_B2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72716"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM26"
FT                   /protein_id="ACC72716.1"
FT                   /translation="MQAHPLRLQPGQDLRDALEHTMHPVGATAVFVVQGIGSLSVARLR
FT                   FAGVEHPTELRADLEILTLAGTVARNGAHLHMSVSGPDGRVFGGHVAHGCIVRTTVEIL
FT                   LALLPDHVFSREPDPQTGFMELFIRNAPRRA"
     MQAHPLRLQP GQDLRDALEH TMHPVGATAV FVVQGIGSLS VARLRFAGVE HPTELRADLE        60
     ILTLAGTVAR NGAHLHMSVS GPDGRVFGGH VAHGCIVRTT VEILLALLPD HVFSREPDPQ       120
     TGFMELFIRN APRRA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page