(data stored in ACNUC29543 zone)

EMBL: CP001044.PE45

CP001044.PE45        Location/Qualifiers
FT   CDS             41947..43665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3146"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; cobalamin (vitamin B12) biosynthesis
FT                   CbiG protein; KEGG: bur:Bcep18194_A4821 precorrin-3B
FT                   C17-methyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3146"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72314"
FT                   /db_xref="GOA:B2JRI7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI7"
FT                   /protein_id="ACC72314.1"
FT                   /translation="MTVPPAIVTLGVGALDTARRVQALYDGAQVHGLQGRVNEADIAYT
FT                   ELGAHLRELYASGTPIVALCAAGIVIRCVAPLLSNKGGEPPVLAVAEDGSAVVPLLGGL
FT                   SGVNAMAREIAGALDVPPAITTSGELRFGACVLNPPEGYALASLDHGKRFVSDLLAGEA
FT                   TRIEGDAPWLDDVQLPRVDNARRTIRVTPLAWSGATDELVIHPRSVVVAVHASATGDNL
FT                   HERVLEAARVQGLAAPSLAVLLAPASQIGDPVLRDVADALHVALRFAADSEAASNAADM
FT                   LRQTLRVPHTAFVTDAPIAFAAAHAPLDPATVGRARGKLSVVGLGPGDASLMVPAARAA
FT                   LTQATDILGYDTYVKMAGPFRAEQRVHGTDNREEMQRARHAFELASAGHHVAMVSSGDP
FT                   GVFAMAAAVLEALDEAHADAHRAAWSAVELEIVPGVSAAFATAAQAGAPLGHDFCVLSL
FT                   SDNLKPWTVIETRLRHAAEADLVMAFYNPISRARPWQLDRALDIVRDLRAPSTVVVLGR
FT                   DIGRPGATLKTTTLAELQSSDVDMRTMVIIGSTTTRAFNAAEPRRTWVYTPRWYA"
     MTVPPAIVTL GVGALDTARR VQALYDGAQV HGLQGRVNEA DIAYTELGAH LRELYASGTP        60
     IVALCAAGIV IRCVAPLLSN KGGEPPVLAV AEDGSAVVPL LGGLSGVNAM AREIAGALDV       120
     PPAITTSGEL RFGACVLNPP EGYALASLDH GKRFVSDLLA GEATRIEGDA PWLDDVQLPR       180
     VDNARRTIRV TPLAWSGATD ELVIHPRSVV VAVHASATGD NLHERVLEAA RVQGLAAPSL       240
     AVLLAPASQI GDPVLRDVAD ALHVALRFAA DSEAASNAAD MLRQTLRVPH TAFVTDAPIA       300
     FAAAHAPLDP ATVGRARGKL SVVGLGPGDA SLMVPAARAA LTQATDILGY DTYVKMAGPF       360
     RAEQRVHGTD NREEMQRARH AFELASAGHH VAMVSSGDPG VFAMAAAVLE ALDEAHADAH       420
     RAAWSAVELE IVPGVSAAFA TAAQAGAPLG HDFCVLSLSD NLKPWTVIET RLRHAAEADL       480
     VMAFYNPISR ARPWQLDRAL DIVRDLRAPS TVVVLGRDIG RPGATLKTTT LAELQSSDVD       540
     MRTMVIIGST TTRAFNAAEP RRTWVYTPRW YA                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page