(data stored in ACNUC29543 zone)

EMBL: CP001044.PE450

CP001044.PE450       Location/Qualifiers
FT   CDS             523599..523787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3580"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72719"
FT                   /db_xref="GOA:B2JM29"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM29"
FT                   /protein_id="ACC72719.1"
FT                   /translation="MALLNMMRMVLWSFFGVRRGAGHEADLATVKLPLLPVMAVVLALC
FT                   FGGLLFAFARIAVTVAH"
     MALLNMMRMV LWSFFGVRRG AGHEADLATV KLPLLPVMAV VLALCFGGLL FAFARIAVTV        60
     AH                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page