(data stored in ACNUC29543 zone)

EMBL: CP001044.PE451

CP001044.PE451       Location/Qualifiers
FT   CDS             complement(523792..525213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3581"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bam:Bamb_3927 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72720"
FT                   /db_xref="GOA:B2JM30"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM30"
FT                   /protein_id="ACC72720.1"
FT                   /translation="MNRYEALANTMAAEIRSGSVAVGARMPSLRQVIAQHGVSQSTAFR
FT                   AYYLLEEWGLIRAQERSGYYVAPGAAVRDTREASPKRALTESAKVDISELVFSVLEAAK
FT                   HTGVVPLGSAFPSPVLFPLQRLSKSLAQTSRTMNPWSTVVDLPPGNEVLRQQIALRYLG
FT                   MGLSQPLDEIVVTNGALEALNLCLMAVTRPGDVVAVESPGFYAALQAIERLDLRAVEIP
FT                   VDPQTGLDLEALAQALETQPIRACWFMTNYQNPTGTTMPLEKKKALVELLARYEVPLIE
FT                   DDVYGELHFQAEYPLPAIAFDRKGLVMHCSSFSKTLAPGYRIGWAAAGRFAEKVQRTKL
FT                   MTTLAASIPVQAGIADYLQHGGYDRHLRKLRAALRVQLEAMNLALRRAMPEGVKWTTPS
FT                   GGYFVWLELPEHVDALALHRQAIEQGVSLAPGPIFSASRNFRNCVRLNFGHPWHADIER
FT                   AIRVLGDLIAQAVQQ"
     MNRYEALANT MAAEIRSGSV AVGARMPSLR QVIAQHGVSQ STAFRAYYLL EEWGLIRAQE        60
     RSGYYVAPGA AVRDTREASP KRALTESAKV DISELVFSVL EAAKHTGVVP LGSAFPSPVL       120
     FPLQRLSKSL AQTSRTMNPW STVVDLPPGN EVLRQQIALR YLGMGLSQPL DEIVVTNGAL       180
     EALNLCLMAV TRPGDVVAVE SPGFYAALQA IERLDLRAVE IPVDPQTGLD LEALAQALET       240
     QPIRACWFMT NYQNPTGTTM PLEKKKALVE LLARYEVPLI EDDVYGELHF QAEYPLPAIA       300
     FDRKGLVMHC SSFSKTLAPG YRIGWAAAGR FAEKVQRTKL MTTLAASIPV QAGIADYLQH       360
     GGYDRHLRKL RAALRVQLEA MNLALRRAMP EGVKWTTPSG GYFVWLELPE HVDALALHRQ       420
     AIEQGVSLAP GPIFSASRNF RNCVRLNFGH PWHADIERAI RVLGDLIAQA VQQ              473
//

If you have problems or comments...

PBIL Back to PBIL home page