(data stored in ACNUC29543 zone)

EMBL: CP001044.PE453

CP001044.PE453       Location/Qualifiers
FT   CDS             526938..527816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3583"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: oan:Oant_3071 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72722"
FT                   /db_xref="GOA:B2JM32"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM32"
FT                   /protein_id="ACC72722.1"
FT                   /translation="MELRHLRYFVAVAERLHFGQAAEALGIAPPTLTVQIQAMERALQA
FT                   QLFRRTRRSVALTSAGEAFLAEARETIAQFERTVNVGERAGRGELGRIRIGYVGSAAFS
FT                   GVLQKQLRAFRKSRPNVLVQATEHPMGELPALLEEGRVDIAFVRLPVDLPPALRAHVLV
FT                   RDAFCVALPAEHSLAAVPGPVKARWLAGESFVVPEQDLGTREVARRGRFSPRIVSTPGS
FT                   LLAVLTQVSVGVGVAVVPNLLTRVVNLPNVVFKTLAGEPIVSEVAAVFRKFEHAPATKK
FT                   LIAQITGAPDQ"
     MELRHLRYFV AVAERLHFGQ AAEALGIAPP TLTVQIQAME RALQAQLFRR TRRSVALTSA        60
     GEAFLAEARE TIAQFERTVN VGERAGRGEL GRIRIGYVGS AAFSGVLQKQ LRAFRKSRPN       120
     VLVQATEHPM GELPALLEEG RVDIAFVRLP VDLPPALRAH VLVRDAFCVA LPAEHSLAAV       180
     PGPVKARWLA GESFVVPEQD LGTREVARRG RFSPRIVSTP GSLLAVLTQV SVGVGVAVVP       240
     NLLTRVVNLP NVVFKTLAGE PIVSEVAAVF RKFEHAPATK KLIAQITGAP DQ               292
//

If you have problems or comments...

PBIL Back to PBIL home page