(data stored in ACNUC29543 zone)

EMBL: CP001044.PE455

CP001044.PE455       Location/Qualifiers
FT   CDS             complement(528523..529098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3585"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bxe:Bxe_B0144 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72724"
FT                   /db_xref="GOA:B2JM34"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM34"
FT                   /protein_id="ACC72724.1"
FT                   /translation="MATLEALQARIKKLQAQAEAIVSKKSTAALETIRALMAKHDLTTA
FT                   DIDAHLGHKKRGRPALKSAGVQKKGVARYIDPKTGATWTGHGRAPAWIAGAKDRSKYLV
FT                   AGASVPAATHAAVKGGTGNGQPKGPQPAKYRHPETGATWSGRGPAPAWLAGEKDRNKFL
FT                   IAGANAAGTNGIARKKTTAKKAGRKARA"
     MATLEALQAR IKKLQAQAEA IVSKKSTAAL ETIRALMAKH DLTTADIDAH LGHKKRGRPA        60
     LKSAGVQKKG VARYIDPKTG ATWTGHGRAP AWIAGAKDRS KYLVAGASVP AATHAAVKGG       120
     TGNGQPKGPQ PAKYRHPETG ATWSGRGPAP AWLAGEKDRN KFLIAGANAA GTNGIARKKT       180
     TAKKAGRKAR A                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page