(data stored in ACNUC29543 zone)

EMBL: CP001044.PE458

CP001044.PE458       Location/Qualifiers
FT   CDS             complement(530430..530969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B3009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72727"
FT                   /db_xref="GOA:B2JM37"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM37"
FT                   /protein_id="ACC72727.1"
FT                   /translation="MISQQAKESIERIFLHSARTRLPIDSADACAIAPLDAQHANEALA
FT                   AHIVVLTISSIAFRFLLVLHFDDDKTTRDYYLRESEDRSLAEALMEVGNLCCGAINQKM
FT                   VEFFPDLGMSTPYQLSGACVPYLTELKPDYLAAFRVTIGANVQLGATLCVCASSHVDFV
FT                   ASIDEAEESTGELELF"
     MISQQAKESI ERIFLHSART RLPIDSADAC AIAPLDAQHA NEALAAHIVV LTISSIAFRF        60
     LLVLHFDDDK TTRDYYLRES EDRSLAEALM EVGNLCCGAI NQKMVEFFPD LGMSTPYQLS       120
     GACVPYLTEL KPDYLAAFRV TIGANVQLGA TLCVCASSHV DFVASIDEAE ESTGELELF        179
//

If you have problems or comments...

PBIL Back to PBIL home page