(data stored in ACNUC29543 zone)

EMBL: CP001044.PE462

CP001044.PE462       Location/Qualifiers
FT   CDS             535745..536773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3592"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0894 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72731"
FT                   /db_xref="GOA:B2JM41"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM41"
FT                   /protein_id="ACC72731.1"
FT                   /translation="MNPISRRPQRRASNLQPVVKGVAAACIAASALWCAGASLAADQPV
FT                   VGLITKTDTNPFFVKMKQGAEAAAQKDGAKLVTAAGKFDGDNAAQVTAIENMITAGAKA
FT                   ILITPSDTKAIVPSIKKARAAGALVIALDTPTDPQDATDALFATDNFKAGVLIGQYAKA
FT                   ALGGKPAKIATLDLAPGVSVGVLRHNGFLQGMGVKEGDPSIVCSQDTRGDQSKGQTAME
FT                   NCLQKSPDINVVYTINEPAAAGAYRALKSAGKEKSVMIVSIDGGCEGVRNVKAGAIAAT
FT                   SQQYPLKMASLGVEAGVEYAKTGKKATGYHDTGVTLITDKPQNGVDSKDTKFGLDNCWG
FT                   NK"
     MNPISRRPQR RASNLQPVVK GVAAACIAAS ALWCAGASLA ADQPVVGLIT KTDTNPFFVK        60
     MKQGAEAAAQ KDGAKLVTAA GKFDGDNAAQ VTAIENMITA GAKAILITPS DTKAIVPSIK       120
     KARAAGALVI ALDTPTDPQD ATDALFATDN FKAGVLIGQY AKAALGGKPA KIATLDLAPG       180
     VSVGVLRHNG FLQGMGVKEG DPSIVCSQDT RGDQSKGQTA MENCLQKSPD INVVYTINEP       240
     AAAGAYRALK SAGKEKSVMI VSIDGGCEGV RNVKAGAIAA TSQQYPLKMA SLGVEAGVEY       300
     AKTGKKATGY HDTGVTLITD KPQNGVDSKD TKFGLDNCWG NK                          342
//

If you have problems or comments...

PBIL Back to PBIL home page