(data stored in ACNUC29543 zone)

EMBL: CP001044.PE464

CP001044.PE464       Location/Qualifiers
FT   CDS             537907..538707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3594"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0892 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72733"
FT                   /db_xref="GOA:B2JM43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM43"
FT                   /protein_id="ACC72733.1"
FT                   /translation="MSTSPSSANGKTAVLQARGLIKRYGHVTALDGCDFEVMPGEIMAV
FT                   IGDNGAGKSSLIKALSGALVPDEGELLLDGKPVKFRSPIDARQQGIETVYQDLAVAPAM
FT                   SIAENLFLARELVKPGWRGKIFKMIDKRRMLEEATNAMKDLQIGIRSMRQAVETLSGGQ
FT                   RQGVAVARSAAFARHVVILDEPTAALGVKEGNMVLELIRRVRDRGLPVILISHNMPHVF
FT                   EIADRIHIQRLGRRAALVNKSDIHMSDAVAIMTGAKQADVRAIA"
     MSTSPSSANG KTAVLQARGL IKRYGHVTAL DGCDFEVMPG EIMAVIGDNG AGKSSLIKAL        60
     SGALVPDEGE LLLDGKPVKF RSPIDARQQG IETVYQDLAV APAMSIAENL FLARELVKPG       120
     WRGKIFKMID KRRMLEEATN AMKDLQIGIR SMRQAVETLS GGQRQGVAVA RSAAFARHVV       180
     ILDEPTAALG VKEGNMVLEL IRRVRDRGLP VILISHNMPH VFEIADRIHI QRLGRRAALV       240
     NKSDIHMSDA VAIMTGAKQA DVRAIA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page