(data stored in ACNUC29543 zone)

EMBL: CP001044.PE465

CP001044.PE465       Location/Qualifiers
FT   CDS             538711..539961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3595"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bxe:Bxe_B0891 ROK"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72734"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM44"
FT                   /protein_id="ACC72734.1"
FT                   /translation="MSTTSQKTSMDTGTRSPLKRTVGSNQVGMRQFNERIVLQAIRLHG
FT                   PLPKADVGRLTRLSMQTVSMIVERLIDDGLLEKQARVRGRIGQPSVPIALRAEGAYTIG
FT                   VKVGRRSLDVLAMDFLGRVCCREVQEYAYPDPRTLFASLDSKLARINDALGARREKVVG
FT                   MGVAAPLWLGGWRDFLGAPPEALDAWNDIDIRTRIASMTGLPVEFAKDTTAACAAELVM
FT                   GQGRGIHNFLYLFVGTFIGGGLVIDGRLHGGPHDNAGAVGSIPIMSGNARRPARQLLHA
FT                   ASGFVLEKLLVDAGAPAAAAHDHRALSADLWRLTEQWLDTACPAIAGALTNAAALLDLE
FT                   AVVIDGEVDRQLVREIIRRTERVLDSFEWEGIVRPQLLEGTIGADARAMGGAILPLYAH
FT                   FAPVHELFLKPAEGVMA"
     MSTTSQKTSM DTGTRSPLKR TVGSNQVGMR QFNERIVLQA IRLHGPLPKA DVGRLTRLSM        60
     QTVSMIVERL IDDGLLEKQA RVRGRIGQPS VPIALRAEGA YTIGVKVGRR SLDVLAMDFL       120
     GRVCCREVQE YAYPDPRTLF ASLDSKLARI NDALGARREK VVGMGVAAPL WLGGWRDFLG       180
     APPEALDAWN DIDIRTRIAS MTGLPVEFAK DTTAACAAEL VMGQGRGIHN FLYLFVGTFI       240
     GGGLVIDGRL HGGPHDNAGA VGSIPIMSGN ARRPARQLLH AASGFVLEKL LVDAGAPAAA       300
     AHDHRALSAD LWRLTEQWLD TACPAIAGAL TNAAALLDLE AVVIDGEVDR QLVREIIRRT       360
     ERVLDSFEWE GIVRPQLLEG TIGADARAMG GAILPLYAHF APVHELFLKP AEGVMA           416
//

If you have problems or comments...

PBIL Back to PBIL home page