(data stored in ACNUC29543 zone)

EMBL: CP001044.PE470

CP001044.PE470       Location/Qualifiers
FT   CDS             548860..549402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3600"
FT                   /product="Cupin domain protein"
FT                   /note="PFAM: Cupin domain protein; KEGG: bxe:Bxe_B1308
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72739"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014500"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM49"
FT                   /protein_id="ACC72739.1"
FT                   /translation="MQAHTRGAVRADVFRLGPRDWVPNNARLPVILYRDVLDAHGTGNG
FT                   GKLAETFEAMFTRNGWPPKWRNGIFDYHHFHSSAHEVLGIAAGAADVIVGGPGGRVVHL
FT                   EAGDVLLLPAGTGHCLESSSGPLEVVGAYPPGQQWDIRRDALTEAERAAMEALPFPQSD
FT                   PVRGAQGPLLENWLKTA"
     MQAHTRGAVR ADVFRLGPRD WVPNNARLPV ILYRDVLDAH GTGNGGKLAE TFEAMFTRNG        60
     WPPKWRNGIF DYHHFHSSAH EVLGIAAGAA DVIVGGPGGR VVHLEAGDVL LLPAGTGHCL       120
     ESSSGPLEVV GAYPPGQQWD IRRDALTEAE RAAMEALPFP QSDPVRGAQG PLLENWLKTA       180
//

If you have problems or comments...

PBIL Back to PBIL home page