(data stored in ACNUC29543 zone)

EMBL: CP001044.PE472

CP001044.PE472       Location/Qualifiers
FT   CDS             complement(550337..551176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3602"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_C0155 ABC nitrate/sulfonate/bicarbonate
FT                   family transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3602"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72741"
FT                   /db_xref="GOA:B2JM51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM51"
FT                   /protein_id="ACC72741.1"
FT                   /translation="MAANPSVLFGDHAATDTAQEAAHSSRLLAVDRVSLEYRTRERVVR
FT                   ATQDVSFDVYGGDRFVLLGPSGCGKSTLLKAVGGFIKPVSGTITLDGETVREPGADRIV
FT                   LFQEFDQLPPWKTVLENIAFPLRVAKKLSRAEAKERAQHYLDKVGLASFAAAYPHTLSG
FT                   GMKQRVAIARALAMQPRVLLMDEPFAALDALTRRKMQEELLRLWEEVRFTLLFVTHSIE
FT                   EALIVGNRILLLSPHPGRVRAELNSHQYTQDSFGRSDFQHRIAQIHRLLFEEMESSR"
     MAANPSVLFG DHAATDTAQE AAHSSRLLAV DRVSLEYRTR ERVVRATQDV SFDVYGGDRF        60
     VLLGPSGCGK STLLKAVGGF IKPVSGTITL DGETVREPGA DRIVLFQEFD QLPPWKTVLE       120
     NIAFPLRVAK KLSRAEAKER AQHYLDKVGL ASFAAAYPHT LSGGMKQRVA IARALAMQPR       180
     VLLMDEPFAA LDALTRRKMQ EELLRLWEEV RFTLLFVTHS IEEALIVGNR ILLLSPHPGR       240
     VRAELNSHQY TQDSFGRSDF QHRIAQIHRL LFEEMESSR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page