(data stored in ACNUC29543 zone)

EMBL: CP001044.PE473

CP001044.PE473       Location/Qualifiers
FT   CDS             complement(551445..552497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3603"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bxe:Bxe_C0154 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72742"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM52"
FT                   /protein_id="ACC72742.1"
FT                   /translation="MLFSIRPAAVRPSLARRFVSSLLALSLGAAGLGASLDAHAEGHIR
FT                   VAEQFGIVYLLLNVARDQQFIEKEGRKEGLDIKVDWVKLSGGSAVNDALLSGSIDVAGA
FT                   GVGPLLTIWDRTHGRQNVKGVASLGNLPYYLVSNNPNVKTIADFTDKDRIALPAVSVSV
FT                   QSRVLQFASAKRWGDKEYNRLDKITQAVPHPDAAAAIIAGGTEITAHFGNPPFQEQELA
FT                   ANPNAHIVLNSYDVLGGPSSATVLYATEKFRNENPKTYRAFVNGLSDAAQFITANPDAA
FT                   ADIYIRVNQAKTDRDLLLSVIRNPQVQFKVAPQNTLGLAQFMYRVGAIRNEPKSWKDYF
FT                   FEDPATASGS"
     MLFSIRPAAV RPSLARRFVS SLLALSLGAA GLGASLDAHA EGHIRVAEQF GIVYLLLNVA        60
     RDQQFIEKEG RKEGLDIKVD WVKLSGGSAV NDALLSGSID VAGAGVGPLL TIWDRTHGRQ       120
     NVKGVASLGN LPYYLVSNNP NVKTIADFTD KDRIALPAVS VSVQSRVLQF ASAKRWGDKE       180
     YNRLDKITQA VPHPDAAAAI IAGGTEITAH FGNPPFQEQE LAANPNAHIV LNSYDVLGGP       240
     SSATVLYATE KFRNENPKTY RAFVNGLSDA AQFITANPDA AADIYIRVNQ AKTDRDLLLS       300
     VIRNPQVQFK VAPQNTLGLA QFMYRVGAIR NEPKSWKDYF FEDPATASGS                  350
//

If you have problems or comments...

PBIL Back to PBIL home page