(data stored in ACNUC29543 zone)

EMBL: CP001044.PE475

CP001044.PE475       Location/Qualifiers
FT   CDS             553786..554232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72744"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM54"
FT                   /protein_id="ACC72744.1"
FT                   /translation="MTKVFIHSITVLAAVGAGLCSEPAFALELDGQLVCKSDAHTFIQP
FT                   LLDDQYIDPNPMRVEANSVNAFRPKRGRDLTAFGFHVYAVLGYQRDDAIFRQGSGAVEA
FT                   NSIYGVVVSGPSESVRVRVQQAGSEATVKQVLPFVLTAIVCSAG"
     MTKVFIHSIT VLAAVGAGLC SEPAFALELD GQLVCKSDAH TFIQPLLDDQ YIDPNPMRVE        60
     ANSVNAFRPK RGRDLTAFGF HVYAVLGYQR DDAIFRQGSG AVEANSIYGV VVSGPSESVR       120
     VRVQQAGSEA TVKQVLPFVL TAIVCSAG                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page