(data stored in ACNUC29543 zone)

EMBL: CP001044.PE480

CP001044.PE480       Location/Qualifiers
FT   CDS             complement(557878..558666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3610"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rso:RSc3138 probable oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3610"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72749"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM59"
FT                   /protein_id="ACC72749.1"
FT                   /translation="MDLKIKGKLALVTGSTKGIGHAIAVGLAREGVQVIINGRSQQSVD
FT                   HASGTLRAQVPDAIVQGFAGDVSDPAQVARLVEQFPHVDILVNNMGIFDPKPFEEISNE
FT                   EWLRFFNVNVMSGVQLSRAYLPKMKQKNWGRVVFISSESGIQIPTEMIHYGLTKTAQLA
FT                   LSRGLAETCAGTAVTVNSVLPGPTSSDGVEEFVEKLSGGASFESFEKQFFQEARPSSIL
FT                   KRFTTPEEIANMVVYVCSELSSATNGAALRADGGVVRSAF"
     MDLKIKGKLA LVTGSTKGIG HAIAVGLARE GVQVIINGRS QQSVDHASGT LRAQVPDAIV        60
     QGFAGDVSDP AQVARLVEQF PHVDILVNNM GIFDPKPFEE ISNEEWLRFF NVNVMSGVQL       120
     SRAYLPKMKQ KNWGRVVFIS SESGIQIPTE MIHYGLTKTA QLALSRGLAE TCAGTAVTVN       180
     SVLPGPTSSD GVEEFVEKLS GGASFESFEK QFFQEARPSS ILKRFTTPEE IANMVVYVCS       240
     ELSSATNGAA LRADGGVVRS AF                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page