(data stored in ACNUC29543 zone)

EMBL: CP001044.PE484

CP001044.PE484       Location/Qualifiers
FT   CDS             complement(562434..563681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3614"
FT                   /product="formyl-CoA transferase"
FT                   /note="TIGRFAM: formyl-CoA transferase; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F; KEGG:
FT                   bxe:Bxe_B2267 acyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72753"
FT                   /db_xref="GOA:B2JM63"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM63"
FT                   /protein_id="ACC72753.1"
FT                   /translation="MGKALDGVRILDFTHVQSGPTCTQLLAWFGADVIKVERAGAGDIT
FT                   REQLRDIPDADSLYFTMLNHNKRSVTIDTKNPEGKLVLEALIQKCDVMVENFAPGALDR
FT                   MGFTWERIQELNPKMIVASVKGFGPGPYEDCKVYENVAQCVGGAASTTGFDDGPPVVTG
FT                   AQIGDSGTGLHLALGIVTALYQRTMTGRGQKVLAAMQDGVLNLCRVKLRDQQRLQRTGV
FT                   MKEYPQYPNGTFGEAVPRAGNASGGGQPGWILKCKGWEHDPNAYIYFITQAPVWVKICN
FT                   VIGKEEWATDADYATPNARLPRLKEIFAEIERWTMTKTKFEAMEILNRHDIPCGPILSM
FT                   KEIMDDESLRKTGTIVEVDHPVRGKYLTVGNPIKLSDSPTEVTRSPLLGEHTDEVMAEL
FT                   GYSPAQIEALRTAGAI"
     MGKALDGVRI LDFTHVQSGP TCTQLLAWFG ADVIKVERAG AGDITREQLR DIPDADSLYF        60
     TMLNHNKRSV TIDTKNPEGK LVLEALIQKC DVMVENFAPG ALDRMGFTWE RIQELNPKMI       120
     VASVKGFGPG PYEDCKVYEN VAQCVGGAAS TTGFDDGPPV VTGAQIGDSG TGLHLALGIV       180
     TALYQRTMTG RGQKVLAAMQ DGVLNLCRVK LRDQQRLQRT GVMKEYPQYP NGTFGEAVPR       240
     AGNASGGGQP GWILKCKGWE HDPNAYIYFI TQAPVWVKIC NVIGKEEWAT DADYATPNAR       300
     LPRLKEIFAE IERWTMTKTK FEAMEILNRH DIPCGPILSM KEIMDDESLR KTGTIVEVDH       360
     PVRGKYLTVG NPIKLSDSPT EVTRSPLLGE HTDEVMAELG YSPAQIEALR TAGAI            415
//

If you have problems or comments...

PBIL Back to PBIL home page