(data stored in ACNUC29543 zone)

EMBL: CP001044.PE487

CP001044.PE487       Location/Qualifiers
FT   CDS             complement(565423..566673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3617"
FT                   /product="formyl-CoA transferase"
FT                   /note="TIGRFAM: formyl-CoA transferase; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F; KEGG:
FT                   bxe:Bxe_B2760 putative formyl-coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72756"
FT                   /db_xref="GOA:B2JM66"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM66"
FT                   /protein_id="ACC72756.1"
FT                   /translation="MSKPLEGVKIIDFTHVQAGPACTQLLAWFGADVIKVERPGAGDVT
FT                   RNQLRDIPDADALYFTMLNSNKRSLTLDTKTQEGKEVLERLIKESDVLVENFAPGALDR
FT                   MGFTWERINELNPKMIVASVKGFSDGHHYDDLKVYENVAQCAGGAASTTGFWDGPPTVS
FT                   AAALGDSNTGMHLAIGILTALIGRDKTGKGQKVAVSMQDSVINLCRVKLRDQQRLDRVG
FT                   YLEEYPQYPHGEFTDVVPRGGNAGGGGQPGWVLKCKGWETDPNAYIYFTVQGHAWEPIC
FT                   RAIGKPEWIDDPAYMTAQARQPHIFDIFNTIEQWLADKTKFEAVDILRKFDIPCSPVLS
FT                   MKEIANDESLRKSGTIVEVDHKARGKYLTVGSPIKFSDMKPEITGSPLLGEHTEEVLAG
FT                   LGYSFEQIANMREAKVV"
     MSKPLEGVKI IDFTHVQAGP ACTQLLAWFG ADVIKVERPG AGDVTRNQLR DIPDADALYF        60
     TMLNSNKRSL TLDTKTQEGK EVLERLIKES DVLVENFAPG ALDRMGFTWE RINELNPKMI       120
     VASVKGFSDG HHYDDLKVYE NVAQCAGGAA STTGFWDGPP TVSAAALGDS NTGMHLAIGI       180
     LTALIGRDKT GKGQKVAVSM QDSVINLCRV KLRDQQRLDR VGYLEEYPQY PHGEFTDVVP       240
     RGGNAGGGGQ PGWVLKCKGW ETDPNAYIYF TVQGHAWEPI CRAIGKPEWI DDPAYMTAQA       300
     RQPHIFDIFN TIEQWLADKT KFEAVDILRK FDIPCSPVLS MKEIANDESL RKSGTIVEVD       360
     HKARGKYLTV GSPIKFSDMK PEITGSPLLG EHTEEVLAGL GYSFEQIANM REAKVV           416
//

If you have problems or comments...

PBIL Back to PBIL home page