(data stored in ACNUC29543 zone)

EMBL: CP001044.PE49

CP001044.PE49        Location/Qualifiers
FT   CDS             complement(55130..55777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3150"
FT                   /product="magnesium chelatase subunit ChlD"
FT                   /note="KEGG: bpm:BURPS1710b_2102 magnesium chelatase
FT                   subunit ChlD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3150"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72318"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ1"
FT                   /protein_id="ACC72318.1"
FT                   /translation="MRSGFRWRQGAGDVSRVGLAGARIAWPRTLAAKRNEQLTTDHLRF
FT                   KHEEAHSGVLHCFLLDCSASMMAGQRLALAKGILVALFDQARMTRDQVALICFGGSEAD
FT                   VRFGPAVPRWWNERWLSPIGGGGGTPLLLGIETAASLLERAARKRPTQQRWLWVFSDGR
FT                   SSGSPVRPRVADEVVFVDFEDSPSRLGRCSRMAGLWRAQCISSDELICARSR"
     MRSGFRWRQG AGDVSRVGLA GARIAWPRTL AAKRNEQLTT DHLRFKHEEA HSGVLHCFLL        60
     DCSASMMAGQ RLALAKGILV ALFDQARMTR DQVALICFGG SEADVRFGPA VPRWWNERWL       120
     SPIGGGGGTP LLLGIETAAS LLERAARKRP TQQRWLWVFS DGRSSGSPVR PRVADEVVFV       180
     DFEDSPSRLG RCSRMAGLWR AQCISSDELI CARSR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page