(data stored in ACNUC29543 zone)

EMBL: CP001044.PE492

CP001044.PE492       Location/Qualifiers
FT   CDS             complement(572587..573306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3622"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_B2268 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72761"
FT                   /db_xref="GOA:B2JM71"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM71"
FT                   /protein_id="ACC72761.1"
FT                   /translation="MSSELGSQPAATPFTLSLQPIGTSASLRDRAYAMLRQAIADADIY
FT                   ASREEIRLDDRALSESLGVSRTPVREAMTLLEQEGFVRTIPRRGIYIVRKSKREIVEMV
FT                   QMWAALESMAARLATLHATDEEIARLRHMFDQFRDSTPAEHIAEYSDANIAFHQAIVEL
FT                   SKSQIILDTIKNIFIHVRAIRRMTISQSDRASRSIVDHLRIIEALEKRDTELAERLTRQ
FT                   HSLDLAAFIEANCDFLD"
     MSSELGSQPA ATPFTLSLQP IGTSASLRDR AYAMLRQAIA DADIYASREE IRLDDRALSE        60
     SLGVSRTPVR EAMTLLEQEG FVRTIPRRGI YIVRKSKREI VEMVQMWAAL ESMAARLATL       120
     HATDEEIARL RHMFDQFRDS TPAEHIAEYS DANIAFHQAI VELSKSQIIL DTIKNIFIHV       180
     RAIRRMTISQ SDRASRSIVD HLRIIEALEK RDTELAERLT RQHSLDLAAF IEANCDFLD        239
//

If you have problems or comments...

PBIL Back to PBIL home page