(data stored in ACNUC29543 zone)

EMBL: CP001044.PE493

CP001044.PE493       Location/Qualifiers
FT   CDS             complement(573873..574604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM72"
FT                   /protein_id="ACC72762.1"
FT                   /translation="MIRYSRAFFELQWQFAERVAVISGMPREQALMHYTNFYIRFGLGR
FT                   QFDANHDVWRIYIDGLSNAADPVDWSGRFYLARPDVPPPSLIAAFGCFSYSNAGNDAIR
FT                   LHFANTDSRDCSPLSRERIGERRGELRTLFDHVDYTRQTQPAIKRVLGASWLYNLPAYR
FT                   SLFPSSYIETARELSSRFQNMPLWGQFLDRHGNVRPDMRARFLERLARQTSLHELAQCF
FT                   PWRALAVDASIALFDGFYRAH"
     MIRYSRAFFE LQWQFAERVA VISGMPREQA LMHYTNFYIR FGLGRQFDAN HDVWRIYIDG        60
     LSNAADPVDW SGRFYLARPD VPPPSLIAAF GCFSYSNAGN DAIRLHFANT DSRDCSPLSR       120
     ERIGERRGEL RTLFDHVDYT RQTQPAIKRV LGASWLYNLP AYRSLFPSSY IETARELSSR       180
     FQNMPLWGQF LDRHGNVRPD MRARFLERLA RQTSLHELAQ CFPWRALAVD ASIALFDGFY       240
     RAH                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page