(data stored in ACNUC29543 zone)

EMBL: CP001044.PE495

CP001044.PE495       Location/Qualifiers
FT   CDS             complement(576141..576494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3625"
FT                   /product="protein of unknown function DUF1428"
FT                   /note="PFAM: protein of unknown function DUF1428; KEGG:
FT                   lpp:lpp2085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72764"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM74"
FT                   /protein_id="ACC72764.1"
FT                   /translation="MNYVDGFVLAVKAENRDLYRRHATTAAGVFKEYGALKVVECWGDD
FT                   VPEGKLTSFPMAVKREPDEVVVFSWVEWPSRAERDEGMKKVMADPRLQPDVMTMPFDGK
FT                   RLIYGGFEVIVDV"
     MNYVDGFVLA VKAENRDLYR RHATTAAGVF KEYGALKVVE CWGDDVPEGK LTSFPMAVKR        60
     EPDEVVVFSW VEWPSRAERD EGMKKVMADP RLQPDVMTMP FDGKRLIYGG FEVIVDV          117
//

If you have problems or comments...

PBIL Back to PBIL home page