(data stored in ACNUC29543 zone)

EMBL: CP001044.PE5

CP001044.PE5         Location/Qualifiers
FT   CDS             3387..3707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3106"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72274"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR48"
FT                   /protein_id="ACC72274.1"
FT                   /translation="MAKHEVQSWYRPPQDEVCPLCGRTIPPEQRDEHHMVPKAEGGRET
FT                   VALHRICHRQLHALFSERELATTYASVDRLLDNEQVRAFVNWVRTKPAGFHERTRSSRR
FT                   KR"
     MAKHEVQSWY RPPQDEVCPL CGRTIPPEQR DEHHMVPKAE GGRETVALHR ICHRQLHALF        60
     SERELATTYA SVDRLLDNEQ VRAFVNWVRT KPAGFHERTR SSRRKR                      106
//

If you have problems or comments...

PBIL Back to PBIL home page