(data stored in ACNUC29543 zone)

EMBL: CP001044.PE503

CP001044.PE503       Location/Qualifiers
FT   CDS             complement(586822..587892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3636"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3636"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72772"
FT                   /db_xref="InterPro:IPR028950"
FT                   /db_xref="InterPro:IPR028966"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM82"
FT                   /protein_id="ACC72772.1"
FT                   /translation="MSAFIYVAGKNDDDARDRAFYLLKKYTSATLLQRAIDLYREFLRD
FT                   FEREIKRPEVEIDYSDDLVRFMRFLQPMEYAEPLLTNPTRRAEAFDMLRDSVKFSSYIW
FT                   GRKYEELGAADPAALFYKLGYREDKTQSVGIFGKASLAGALLSLLFGTLNKKGKLFLSK
FT                   PLATARTSMCWTYESIFFDDLPINRIPAIRFPAHLSPCPPRNEDNTGEVWSGRQIPVTG
FT                   IWEPWAINPKIGVRCPNYYLAGDTASQYQFEGTDTLEDVRWRLIWKDSRYASGQTPYEE
FT                   DEYFAPDPSANLNAPIMRKASPGEVCPESGEWFAPNLNNKTFTMNAGEIMPGPELGSTG
FT                   AVIWYLKPRSDSGSAL"
     MSAFIYVAGK NDDDARDRAF YLLKKYTSAT LLQRAIDLYR EFLRDFEREI KRPEVEIDYS        60
     DDLVRFMRFL QPMEYAEPLL TNPTRRAEAF DMLRDSVKFS SYIWGRKYEE LGAADPAALF       120
     YKLGYREDKT QSVGIFGKAS LAGALLSLLF GTLNKKGKLF LSKPLATART SMCWTYESIF       180
     FDDLPINRIP AIRFPAHLSP CPPRNEDNTG EVWSGRQIPV TGIWEPWAIN PKIGVRCPNY       240
     YLAGDTASQY QFEGTDTLED VRWRLIWKDS RYASGQTPYE EDEYFAPDPS ANLNAPIMRK       300
     ASPGEVCPES GEWFAPNLNN KTFTMNAGEI MPGPELGSTG AVIWYLKPRS DSGSAL           356
//

If you have problems or comments...

PBIL Back to PBIL home page