(data stored in ACNUC29543 zone)

EMBL: CP001044.PE504

CP001044.PE504       Location/Qualifiers
FT   CDS             complement(587904..589451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3637"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72773"
FT                   /db_xref="GOA:B2JM83"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM83"
FT                   /protein_id="ACC72773.1"
FT                   /translation="MSDITVSNPAESRIGAIETGKRIWANAAAAADWVGGALKGEFGQQ
FT                   QTTGQIVFDATISMFPVLGEGTAARDTIAIMMHMADNRQAVEDRWTWIKLVLCLIAVVP
FT                   IFGGVLKGVGKLVIRAFEKSEDLAKLAEELVLFVNRMCHGNAYEWLRKLDFTTYQGKVI
FT                   DGLTDALDRFSGACQYIVRNMGNVLPSHVVAYLSGMPAKLQPIRNAANRMIPQALRDMN
FT                   NCLARVRAHMVEGTWADISVGSGKITTREAEGQLSTLARDAGKAPHPPASLEDYHHVEG
FT                   WPDLREAPHVAINDETKDATYTVIESFSRLKPIEAVTLGPGQYVLARVLDNTERTTKSG
FT                   YKLKGVVSETTKRSKNWLPRMAKNGREWREKWAVKMDWNHNGAYITLDHIPTIEELRAA
FT                   GVPNIPQDWTGLRIWRGEVSSQFDEDLGRWLEGGETQFIIDFDDAYNKVWEEYVKRLPV
FT                   KPTNWTDVNFAPVDRAAVRPLDKDQTLPKTVPQGYTNRAPAVAGRALPGTDAAQPQH"
     MSDITVSNPA ESRIGAIETG KRIWANAAAA ADWVGGALKG EFGQQQTTGQ IVFDATISMF        60
     PVLGEGTAAR DTIAIMMHMA DNRQAVEDRW TWIKLVLCLI AVVPIFGGVL KGVGKLVIRA       120
     FEKSEDLAKL AEELVLFVNR MCHGNAYEWL RKLDFTTYQG KVIDGLTDAL DRFSGACQYI       180
     VRNMGNVLPS HVVAYLSGMP AKLQPIRNAA NRMIPQALRD MNNCLARVRA HMVEGTWADI       240
     SVGSGKITTR EAEGQLSTLA RDAGKAPHPP ASLEDYHHVE GWPDLREAPH VAINDETKDA       300
     TYTVIESFSR LKPIEAVTLG PGQYVLARVL DNTERTTKSG YKLKGVVSET TKRSKNWLPR       360
     MAKNGREWRE KWAVKMDWNH NGAYITLDHI PTIEELRAAG VPNIPQDWTG LRIWRGEVSS       420
     QFDEDLGRWL EGGETQFIID FDDAYNKVWE EYVKRLPVKP TNWTDVNFAP VDRAAVRPLD       480
     KDQTLPKTVP QGYTNRAPAV AGRALPGTDA AQPQH                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page