(data stored in ACNUC29543 zone)

EMBL: CP001044.PE507

CP001044.PE507       Location/Qualifiers
FT   CDS             complement(592381..595206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3640"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG: bam:Bamb_5366
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3640"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72776"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI2"
FT                   /protein_id="ACC72776.1"
FT                   /translation="MKDERFPFLYRAPARTLSISGDALPTWTPPRVNIKFEESPKPVLI
FT                   PIYLHGREAIGELFSYTVRMRTDIDIPSFPDNTTIDLDSIVGTQVTIFIDVPGKATPIP
FT                   GMPGDTGRGNIGFYTREITGRVSAARFVRRDGRSMVYEFEVEPALAEAAKGSNYRIFMG
FT                   ETVTDVIGKILGNYPIAIDWRIGGPHYGKRVYPRRDLIRQHWEADMTSVQRLCEHYGLF
FT                   YWFEHENGFHRIVIADTMGAFHPHGEAYEQIRFSTNDRIDEEHVDRLDVTSRQTEGKIT
FT                   VVDHDYTEPRVAPSTVPLREDFRDPRDTARADQEVYTYANVSQPRLEEARFDSTPEDTR
FT                   DDARNVAMVRMQALRCQGLRAKGHGNIRGLTVGRTFHLTDHPYQKSNQEYLVVSATLTI
FT                   EENDQASGTGQAFRCETDFEIQPTREYFRMPHKTPWPSQAGFEYAIVTGPENQEIWTDV
FT                   YGRVKCQLIPDREGKLDQDAFIWVLPMQPWQNGQMGSAFVPRIGSQVLIGYVNGNPDMP
FT                   FIVASSANKRNTPGWKLPFNQWVSGFRSRMEGGHSANHLALVDTKNELQAQLSSDHGTS
FT                   QLSLGFIRRLLGNEGLKDARGEGFDLRTDFWGSVRAAMGIFITTHGRPNAEGKAKDAGE
FT                   TVTRLTQARDMHEGLVGLAQQHGAQIPDADQSDVTRSIKQQTADLRGTAKGGPNDFPEF
FT                   ATPLIALSSPAGIGTSTAGSTHIQSDEDTAITTGRSIGIAAGKSFHASVLERISLFVRK
FT                   AGMMLVAASGKIRIEAQGDDIDVIAKKDVQITSEDGWINLTAMKGIRFNGAGTTVELSA
FT                   AGLLGATNGKFLVHAADHSTDGPRSTPPAFAPKTYTDKSSLSHLYHDGEPVQGAKFDIR
FT                   YDDGKRYSGTLDNAGHADLSSAPVGAGRMKIGPDSRPVQVKANEPNPDYKPKWGESDFR
FT                   ASANKQNNGDA"
     MKDERFPFLY RAPARTLSIS GDALPTWTPP RVNIKFEESP KPVLIPIYLH GREAIGELFS        60
     YTVRMRTDID IPSFPDNTTI DLDSIVGTQV TIFIDVPGKA TPIPGMPGDT GRGNIGFYTR       120
     EITGRVSAAR FVRRDGRSMV YEFEVEPALA EAAKGSNYRI FMGETVTDVI GKILGNYPIA       180
     IDWRIGGPHY GKRVYPRRDL IRQHWEADMT SVQRLCEHYG LFYWFEHENG FHRIVIADTM       240
     GAFHPHGEAY EQIRFSTNDR IDEEHVDRLD VTSRQTEGKI TVVDHDYTEP RVAPSTVPLR       300
     EDFRDPRDTA RADQEVYTYA NVSQPRLEEA RFDSTPEDTR DDARNVAMVR MQALRCQGLR       360
     AKGHGNIRGL TVGRTFHLTD HPYQKSNQEY LVVSATLTIE ENDQASGTGQ AFRCETDFEI       420
     QPTREYFRMP HKTPWPSQAG FEYAIVTGPE NQEIWTDVYG RVKCQLIPDR EGKLDQDAFI       480
     WVLPMQPWQN GQMGSAFVPR IGSQVLIGYV NGNPDMPFIV ASSANKRNTP GWKLPFNQWV       540
     SGFRSRMEGG HSANHLALVD TKNELQAQLS SDHGTSQLSL GFIRRLLGNE GLKDARGEGF       600
     DLRTDFWGSV RAAMGIFITT HGRPNAEGKA KDAGETVTRL TQARDMHEGL VGLAQQHGAQ       660
     IPDADQSDVT RSIKQQTADL RGTAKGGPND FPEFATPLIA LSSPAGIGTS TAGSTHIQSD       720
     EDTAITTGRS IGIAAGKSFH ASVLERISLF VRKAGMMLVA ASGKIRIEAQ GDDIDVIAKK       780
     DVQITSEDGW INLTAMKGIR FNGAGTTVEL SAAGLLGATN GKFLVHAADH STDGPRSTPP       840
     AFAPKTYTDK SSLSHLYHDG EPVQGAKFDI RYDDGKRYSG TLDNAGHADL SSAPVGAGRM       900
     KIGPDSRPVQ VKANEPNPDY KPKWGESDFR ASANKQNNGD A                           941
//

If you have problems or comments...

PBIL Back to PBIL home page