(data stored in ACNUC29543 zone)

EMBL: CP001044.PE516

CP001044.PE516       Location/Qualifiers
FT   CDS             complement(603989..604192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_2658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ1"
FT                   /protein_id="ACC72785.1"
FT                   /translation="MGILDTLGEIAGAAAAVEALEKADPNASLLTKGVAAVAGFKGAGA
FT                   LEELVGQKTEDDSADNAESGQT"
     MGILDTLGEI AGAAAAVEAL EKADPNASLL TKGVAAVAGF KGAGALEELV GQKTEDDSAD        60
     NAESGQT                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page