(data stored in ACNUC29543 zone)

EMBL: CP001044.PE52

CP001044.PE52        Location/Qualifiers
FT   CDS             complement(60646..61755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3153"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobW; PFAM:
FT                   cobalamin synthesis protein P47K; cobalamin synthesis CobW
FT                   domain protein; KEGG: bxe:Bxe_B1647 CobW"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3153"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72321"
FT                   /db_xref="GOA:B2JRJ4"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ4"
FT                   /protein_id="ACC72321.1"
FT                   /translation="MQTQMRKIPVTIVTGFLGSGKTTLMRHILQRAGGLRIAVIVNEFG
FT                   ELGIDGEILKGCGIGCDENGNETEGQLYELANGCLCCTVQEEFLPVMEQLVERRGQIDH
FT                   VLIETSGLALPKPLVQAFNWPSIKNSFTVDAVVTVVDGPAVASGQFADDPVAVDRLRKA
FT                   DPNLDHESPLHELFEDQLSAADLVILNKTDLLDEAQQAAVESTLREEIPPQVKVVRAHM
FT                   GQLDLHALLGLESASEETIHLRHDHHGSADDPDHADHHHDEFDSVVVTVRAPSRETMIA
FT                   ALTQVVEGHAIYRVKGFAALPGAAMRLVIQGVGRRFDSYFDRRWQAGEVDSATLSRFVL
FT                   IGSDLDQRVLQRALDEALNDIMSAQAQQA"
     MQTQMRKIPV TIVTGFLGSG KTTLMRHILQ RAGGLRIAVI VNEFGELGID GEILKGCGIG        60
     CDENGNETEG QLYELANGCL CCTVQEEFLP VMEQLVERRG QIDHVLIETS GLALPKPLVQ       120
     AFNWPSIKNS FTVDAVVTVV DGPAVASGQF ADDPVAVDRL RKADPNLDHE SPLHELFEDQ       180
     LSAADLVILN KTDLLDEAQQ AAVESTLREE IPPQVKVVRA HMGQLDLHAL LGLESASEET       240
     IHLRHDHHGS ADDPDHADHH HDEFDSVVVT VRAPSRETMI AALTQVVEGH AIYRVKGFAA       300
     LPGAAMRLVI QGVGRRFDSY FDRRWQAGEV DSATLSRFVL IGSDLDQRVL QRALDEALND       360
     IMSAQAQQA                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page