(data stored in ACNUC29543 zone)

EMBL: CP001044.PE520

CP001044.PE520       Location/Qualifiers
FT   CDS             complement(606479..607678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3654"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A0821 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3654"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72789"
FT                   /db_xref="GOA:B2JMJ5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ5"
FT                   /protein_id="ACC72789.1"
FT                   /translation="MNNLAKLTLVGISLTSLTLMGCGRKEQPSQHATQDEAGSAEEVVK
FT                   IGHVGPLTGGSSHLGKDNENGARLAVEDINKTGLVIGGRKVRLELDGEDDAADPKTGTQ
FT                   IAQKFVDEHVVAVIGHLNSGVSIPASRIYNEANIAEISPSSTNPDYTKQGYRSAYRVVA
FT                   TDAQQGPALGGYALRSLGAKTIAVVDDATAYGKGLADEFAKAAQAGGARIVAREATTDK
FT                   ATDFRAILTAIKSAHPDVIMFGGMDSTVGPFIRQAAALGLNTRVLSGDGACTEKVAELA
FT                   GDSVNILVCSEASLAVSRMPKGAEFQKRFEARFNGPILFNAPFAYDAVYVIADAMRRAN
FT                   TTDAAKVLAALPATDYNGVIGHIAFDAHGDMKAGAITLYHYQDKKKTLLDVVKYGNAST
FT                   "
     MNNLAKLTLV GISLTSLTLM GCGRKEQPSQ HATQDEAGSA EEVVKIGHVG PLTGGSSHLG        60
     KDNENGARLA VEDINKTGLV IGGRKVRLEL DGEDDAADPK TGTQIAQKFV DEHVVAVIGH       120
     LNSGVSIPAS RIYNEANIAE ISPSSTNPDY TKQGYRSAYR VVATDAQQGP ALGGYALRSL       180
     GAKTIAVVDD ATAYGKGLAD EFAKAAQAGG ARIVAREATT DKATDFRAIL TAIKSAHPDV       240
     IMFGGMDSTV GPFIRQAAAL GLNTRVLSGD GACTEKVAEL AGDSVNILVC SEASLAVSRM       300
     PKGAEFQKRF EARFNGPILF NAPFAYDAVY VIADAMRRAN TTDAAKVLAA LPATDYNGVI       360
     GHIAFDAHGD MKAGAITLYH YQDKKKTLLD VVKYGNAST                              399
//

If you have problems or comments...

PBIL Back to PBIL home page