(data stored in ACNUC29543 zone)

EMBL: CP001044.PE522

CP001044.PE522       Location/Qualifiers
FT   CDS             complement(608315..609907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3656"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="TIGRFAM: alkyl hydroperoxide reductase, F subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bxe:Bxe_B1206 AhpF"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3656"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72791"
FT                   /db_xref="GOA:B2JMJ7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ7"
FT                   /protein_id="ACC72791.1"
FT                   /translation="MLDANLKTQLKAYLEKVSRPIEIVASLDDGTKSQELLALLNDIAS
FT                   LSERVNVIERRGDDERKPSFSIGEPGKTTGIRFAGIPMGHEFTSLVLALLQTGGHPIKL
FT                   DDAVIQQIRELDGDFAFETYFSLSCQNCPEVVQALNIMALINPRIRHTAIDGALFQNEV
FT                   ESRQIMAVPTMFLNGEVFGQGRSGVKEILAKLDSNAGARAAKELEKKPVFDMLIVGGGP
FT                   AGAAAAIYSARKGIATGVVAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVKSYE
FT                   VDVMDVQRAEALIPGKINEVRLAGGAVLKAKTIVLATGARWREINVPGEREYRNHGVAY
FT                   CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGVVNHVTLIEFGATLRADEVLQRKLRSL
FT                   PNVVVITQAQTTEITGDGKKVNGLTYTDRVSGESKHVELEGVFVQIGLVPNTEWLKGTV
FT                   ELSKHGEIVVDAKGATSVPGVFAAGDVTTVPFKQIVIAVGEGAKASLAAFDHLIRTSVE
FT                   DAEDAQAAAMAEV"
     MLDANLKTQL KAYLEKVSRP IEIVASLDDG TKSQELLALL NDIASLSERV NVIERRGDDE        60
     RKPSFSIGEP GKTTGIRFAG IPMGHEFTSL VLALLQTGGH PIKLDDAVIQ QIRELDGDFA       120
     FETYFSLSCQ NCPEVVQALN IMALINPRIR HTAIDGALFQ NEVESRQIMA VPTMFLNGEV       180
     FGQGRSGVKE ILAKLDSNAG ARAAKELEKK PVFDMLIVGG GPAGAAAAIY SARKGIATGV       240
     VAERFGGQVL DTLAIENFVS VQETEGPKFA TALEQHVKSY EVDVMDVQRA EALIPGKINE       300
     VRLAGGAVLK AKTIVLATGA RWREINVPGE REYRNHGVAY CPHCDGPLFK GKRVAVVGGG       360
     NSGVEAAIDL AGVVNHVTLI EFGATLRADE VLQRKLRSLP NVVVITQAQT TEITGDGKKV       420
     NGLTYTDRVS GESKHVELEG VFVQIGLVPN TEWLKGTVEL SKHGEIVVDA KGATSVPGVF       480
     AAGDVTTVPF KQIVIAVGEG AKASLAAFDH LIRTSVEDAE DAQAAAMAEV                  530
//

If you have problems or comments...

PBIL Back to PBIL home page