(data stored in ACNUC29543 zone)

EMBL: CP001044.PE523

CP001044.PE523       Location/Qualifiers
FT   CDS             complement(610100..610663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3657"
FT                   /product="peroxiredoxin"
FT                   /note="TIGRFAM: peroxiredoxin; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Redoxin domain protein; KEGG: bte:BTH_II1926 alkyl
FT                   hydroperoxide reductase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3657"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72792"
FT                   /db_xref="GOA:B2JMJ8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ8"
FT                   /protein_id="ACC72792.1"
FT                   /translation="MPIINSQVKPFKATAFHNGDFVTVTDETLKGKWSVVVFYPADFTF
FT                   VCPTELGDLADRYEEFKKLGVEIYSVSTDTHFTHKAWHDTSDTIQKIKYPMVADPTLAI
FT                   SRNFDVLIEEEGLALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAAHPG
FT                   EVCPAKWTPGAETLSPSLDLIGKI"
     MPIINSQVKP FKATAFHNGD FVTVTDETLK GKWSVVVFYP ADFTFVCPTE LGDLADRYEE        60
     FKKLGVEIYS VSTDTHFTHK AWHDTSDTIQ KIKYPMVADP TLAISRNFDV LIEEEGLALR       120
     GTFVINPEGE IKLCEIHDNG IGRDAGELLR KVQAAQYIAA HPGEVCPAKW TPGAETLSPS       180
     LDLIGKI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page