(data stored in ACNUC29543 zone)

EMBL: CP001044.PE528

CP001044.PE528       Location/Qualifiers
FT   CDS             615445..615729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3662"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72797"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK3"
FT                   /protein_id="ACC72797.1"
FT                   /translation="MSSRHDRSDPSEPNACDAQDWSSPRAYPEADLMRGLQLASDTVLR
FT                   LATQTHAAVARGDPASAEAARESLEKQLALTTRLIDELLFDGEVRHTTH"
     MSSRHDRSDP SEPNACDAQD WSSPRAYPEA DLMRGLQLAS DTVLRLATQT HAAVARGDPA        60
     SAEAARESLE KQLALTTRLI DELLFDGEVR HTTH                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page