(data stored in ACNUC29543 zone)

EMBL: CP001044.PE529

CP001044.PE529       Location/Qualifiers
FT   CDS             complement(615792..616118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3663"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72798"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK4"
FT                   /protein_id="ACC72798.1"
FT                   /translation="MRRRADAQRGAVARGMARTRDRELMKEPDSRRARRLEGEGARPLP
FT                   DRARSSDRWRDYSAIEKREGRACFAFDGRSTRGLAPRMNSTAQSATIAQTERSIVKTFI
FT                   SNSS"
     MRRRADAQRG AVARGMARTR DRELMKEPDS RRARRLEGEG ARPLPDRARS SDRWRDYSAI        60
     EKREGRACFA FDGRSTRGLA PRMNSTAQSA TIAQTERSIV KTFISNSS                    108
//

If you have problems or comments...

PBIL Back to PBIL home page