(data stored in ACNUC29543 zone)

EMBL: CP001044.PE537

CP001044.PE537       Location/Qualifiers
FT   CDS             622619..623083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3671"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72806"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML2"
FT                   /protein_id="ACC72806.1"
FT                   /translation="MPNVCGLHIKFAVLVPTNRYSVNDFWERFVKQLAICMVLAVMTGC
FT                   AQLPANTASQADKAPVSNDVISFTIPPDALGARDPQLSAVLAKAGALAAAQKQPTTILV
FT                   TALGQDLPYLNQAIWRGVPSQHPAKLSLENLTAGANQPYSVSIRPTGGTP"
     MPNVCGLHIK FAVLVPTNRY SVNDFWERFV KQLAICMVLA VMTGCAQLPA NTASQADKAP        60
     VSNDVISFTI PPDALGARDP QLSAVLAKAG ALAAAQKQPT TILVTALGQD LPYLNQAIWR       120
     GVPSQHPAKL SLENLTAGAN QPYSVSIRPT GGTP                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page