(data stored in ACNUC29543 zone)

EMBL: CP001044.PE538

CP001044.PE538       Location/Qualifiers
FT   CDS             623080..623463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3672"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2895 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3672"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72807"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML3"
FT                   /protein_id="ACC72807.1"
FT                   /translation="MRGSHVMFRTAILAASLALAAFMSQAALAGQPATAGALSSSGSSA
FT                   APAPSAAADKVYPPLPTLAMLPPSAGDDDEPPLAPKPAAKKRKVRASVDVRPTAPAARL
FT                   VVSDTTRTYLRSVEKQLDLALAK"
     MRGSHVMFRT AILAASLALA AFMSQAALAG QPATAGALSS SGSSAAPAPS AAADKVYPPL        60
     PTLAMLPPSA GDDDEPPLAP KPAAKKRKVR ASVDVRPTAP AARLVVSDTT RTYLRSVEKQ       120
     LDLALAK                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page