(data stored in ACNUC29543 zone)

EMBL: CP001044.PE54

CP001044.PE54        Location/Qualifiers
FT   CDS             63515..63949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3155"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: cvi:CV_1563 precorrin methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3155"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72323"
FT                   /db_xref="GOA:B2JRJ6"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ6"
FT                   /protein_id="ACC72323.1"
FT                   /translation="MTGLIVGIGCRRGVSAEQIEAAVRDALGGTLPFDALGAVATVDMK
FT                   AGEPGLVAFCARHALPLRTFTREQIAALDARTNASHAVREHMGVDGVCEPCALLATQNG
FT                   RLLVHKRARDGVTVAIACAADAGRAIHQHSNYTPGSKDNR"
     MTGLIVGIGC RRGVSAEQIE AAVRDALGGT LPFDALGAVA TVDMKAGEPG LVAFCARHAL        60
     PLRTFTREQI AALDARTNAS HAVREHMGVD GVCEPCALLA TQNGRLLVHK RARDGVTVAI       120
     ACAADAGRAI HQHSNYTPGS KDNR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page