(data stored in ACNUC29543 zone)

EMBL: CP001044.PE541

CP001044.PE541       Location/Qualifiers
FT   CDS             625063..625455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72810"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML6"
FT                   /protein_id="ACC72810.1"
FT                   /translation="MEVERVERIVVALRRAAEHERLVSYQRFHAMFGASDPLTARYDAL
FT                   ERAIASLGEVSNIDYGVLLALSNGLPGPDFFRRYQKHRYADYVAVMGPPIHRQSIKRKR
FT                   LLVEAERRRVYEDARRKASCHAAETA"
     MEVERVERIV VALRRAAEHE RLVSYQRFHA MFGASDPLTA RYDALERAIA SLGEVSNIDY        60
     GVLLALSNGL PGPDFFRRYQ KHRYADYVAV MGPPIHRQSI KRKRLLVEAE RRRVYEDARR       120
     KASCHAAETA                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page