(data stored in ACNUC29543 zone)

EMBL: CP001044.PE543

CP001044.PE543       Location/Qualifiers
FT   CDS             626199..626462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3677"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3677"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72812"
FT                   /db_xref="GOA:B2JML8"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML8"
FT                   /protein_id="ACC72812.1"
FT                   /translation="MSLLASARMVNPMPIEPWNSAKRRARRKMIWSKAHVVLAAIGTLS
FT                   AVAGIAVAINGGLEFNRTKVFVGVGIIIVSTILYVSMLFVDD"
     MSLLASARMV NPMPIEPWNS AKRRARRKMI WSKAHVVLAA IGTLSAVAGI AVAINGGLEF        60
     NRTKVFVGVG IIIVSTILYV SMLFVDD                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page