(data stored in ACNUC29543 zone)

EMBL: CP001044.PE544

CP001044.PE544       Location/Qualifiers
FT   CDS             complement(626469..627725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3678"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; KEGG: bxe:Bxe_B2239
FT                   putative diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72813"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML9"
FT                   /protein_id="ACC72813.1"
FT                   /translation="MKLRVRCIKRTSLRLVESKKQVATGVATVGLKQTHIEADNQTLGP
FT                   AAGRNATAPMSTTHTPHSVRLRALVDTVQRNERTLRRFQDVELHLIRAQDFQALCSVLF
FT                   DYLPREFGLERVMLWLNDTLPLLHEMASRHVTPPTAGSPAGSLNTSRETGDAATRLCAQ
FT                   GRPWLGACASMDDAARDALRAGDMPAASIALLPLAANGLLSGYLCLGSDNASRFAAGMA
FT                   TDMLERFAVIVAASLDNVAHREQLERLGATDALTGLPNRRYFDERLREETMRASRYRLP
FT                   LGCLFIDIDGFKPINDAHGHAIGDRALALVGACLRKQTRLGDTIARYGGEEFAVLLQGD
FT                   LKDSLAVAERMRTAVAQLELHDNGGARIPLTVSIGASAHAMQSGSDLDRLGRTLVDEAD
FT                   RAMYKAKADGRNRVVTLVT"
     MKLRVRCIKR TSLRLVESKK QVATGVATVG LKQTHIEADN QTLGPAAGRN ATAPMSTTHT        60
     PHSVRLRALV DTVQRNERTL RRFQDVELHL IRAQDFQALC SVLFDYLPRE FGLERVMLWL       120
     NDTLPLLHEM ASRHVTPPTA GSPAGSLNTS RETGDAATRL CAQGRPWLGA CASMDDAARD       180
     ALRAGDMPAA SIALLPLAAN GLLSGYLCLG SDNASRFAAG MATDMLERFA VIVAASLDNV       240
     AHREQLERLG ATDALTGLPN RRYFDERLRE ETMRASRYRL PLGCLFIDID GFKPINDAHG       300
     HAIGDRALAL VGACLRKQTR LGDTIARYGG EEFAVLLQGD LKDSLAVAER MRTAVAQLEL       360
     HDNGGARIPL TVSIGASAHA MQSGSDLDRL GRTLVDEADR AMYKAKADGR NRVVTLVT         418
//

If you have problems or comments...

PBIL Back to PBIL home page