(data stored in ACNUC29543 zone)

EMBL: CP001044.PE545

CP001044.PE545       Location/Qualifiers
FT   CDS             complement(627732..627926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3679"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II2151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3679"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72814"
FT                   /db_xref="GOA:B2JMM0"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM0"
FT                   /protein_id="ACC72814.1"
FT                   /translation="MRLLLALLLPWFQFFTIGRPFAGIICLVLQLTIIGWLPAAIWSVY
FT                   ALSQYKTDRKIEAALGRRS"
     MRLLLALLLP WFQFFTIGRP FAGIICLVLQ LTIIGWLPAA IWSVYALSQY KTDRKIEAAL        60
     GRRS                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page