(data stored in ACNUC29543 zone)

EMBL: CP001044.PE546

CP001044.PE546       Location/Qualifiers
FT   CDS             complement(627956..628291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3680"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   bte:BTH_I2656 domain of unknown function, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3680"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72815"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JMM1"
FT                   /protein_id="ACC72815.1"
FT                   /translation="MIERHMVSTTFDLPGHTVDASLGMVRGIIVRSRSVVGSIGAGLQT
FT                   IFGGNISLYTSLCERARQDAYERMLADAAMLGANAVIGMRYDATEIGAGVTEVLCYGTA
FT                   VHARRNV"
     MIERHMVSTT FDLPGHTVDA SLGMVRGIIV RSRSVVGSIG AGLQTIFGGN ISLYTSLCER        60
     ARQDAYERML ADAAMLGANA VIGMRYDATE IGAGVTEVLC YGTAVHARRN V                111
//

If you have problems or comments...

PBIL Back to PBIL home page