(data stored in ACNUC29543 zone)

EMBL: CP001044.PE547

CP001044.PE547       Location/Qualifiers
FT   CDS             complement(628323..629045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3681"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bxe:Bxe_B2868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3681"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72816"
FT                   /db_xref="GOA:B2JMM2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM2"
FT                   /protein_id="ACC72816.1"
FT                   /translation="MSYLLVLAVGLAAGTLSGVIGTGSSMLLMPVLVMLSGPQQAVPIM
FT                   AIAAIMGNFGKVLAWWREIDWRACGAYCSTAVPGAALGVRTLLALPPHAVEIALGLFFV
FT                   AMVPARRWLARRAVRFSRWHLAAIGGPVGFLTGIVVSTGPITVPVFIGYGLVKGAFLAT
FT                   EAAGSLAVYGAKVATFDHFGALPLHVVLDGLITGSALMAGAFCARRIVVRMSPGTFRLV
FT                   VDGLMLSSGLSLLWAAGR"
     MSYLLVLAVG LAAGTLSGVI GTGSSMLLMP VLVMLSGPQQ AVPIMAIAAI MGNFGKVLAW        60
     WREIDWRACG AYCSTAVPGA ALGVRTLLAL PPHAVEIALG LFFVAMVPAR RWLARRAVRF       120
     SRWHLAAIGG PVGFLTGIVV STGPITVPVF IGYGLVKGAF LATEAAGSLA VYGAKVATFD       180
     HFGALPLHVV LDGLITGSAL MAGAFCARRI VVRMSPGTFR LVVDGLMLSS GLSLLWAAGR       240
//

If you have problems or comments...

PBIL Back to PBIL home page