(data stored in ACNUC29543 zone)

EMBL: CP001044.PE552

CP001044.PE552       Location/Qualifiers
FT   CDS             634333..635514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3686"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: bvi:Bcep1808_6166 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72821"
FT                   /db_xref="GOA:B2JMM7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM7"
FT                   /protein_id="ACC72821.1"
FT                   /translation="MDVILVINAGSSSIKFHAFHAQGAQLEPIAGGKLEEIYTNPRFTA
FT                   KRQNGEVIEDKRWPEGEQLGHDNAIAFLLDWLRSHGEGRATLLAVGHRVVHGGDKYAEP
FT                   VRVDAKVMEELEALVPLAPLHQPHNLAAIRSIMARNTNVPQIACFDTAFHHTQPAVATR
FT                   FALPPDITSRGVRRYGFHGLSYEYIASVLPQVDERAAKGKTVVMHLGNGASMAAFDGCK
FT                   SIASTMGFTAVEGLVMGTRSGSLDPGVVLWMLEEANMDARAIESLLYKRSGLLGVSGIS
FT                   SDMRTLLASDDPKAAEAVELFCYRISRELGSLAAALGGLDAIVFTAGIGERADAVRKRV
FT                   GQLAAWLGVSLDEAANQRHGPCISDAKSAVDVWVIPTNEELMIARHALSRLES"
     MDVILVINAG SSSIKFHAFH AQGAQLEPIA GGKLEEIYTN PRFTAKRQNG EVIEDKRWPE        60
     GEQLGHDNAI AFLLDWLRSH GEGRATLLAV GHRVVHGGDK YAEPVRVDAK VMEELEALVP       120
     LAPLHQPHNL AAIRSIMARN TNVPQIACFD TAFHHTQPAV ATRFALPPDI TSRGVRRYGF       180
     HGLSYEYIAS VLPQVDERAA KGKTVVMHLG NGASMAAFDG CKSIASTMGF TAVEGLVMGT       240
     RSGSLDPGVV LWMLEEANMD ARAIESLLYK RSGLLGVSGI SSDMRTLLAS DDPKAAEAVE       300
     LFCYRISREL GSLAAALGGL DAIVFTAGIG ERADAVRKRV GQLAAWLGVS LDEAANQRHG       360
     PCISDAKSAV DVWVIPTNEE LMIARHALSR LES                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page