(data stored in ACNUC29543 zone)

EMBL: CP001044.PE554

CP001044.PE554       Location/Qualifiers
FT   CDS             636302..636724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3688"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72823"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM9"
FT                   /protein_id="ACC72823.1"
FT                   /translation="MACTELLAGGLPQNASLDEINTLVYRYSPADCSAIELVGGADEHT
FT                   AALIAINGANVTALNPALNPALNPIRRRPCEPACKPFSPTPRCTSAHLLPPALTLPPLC
FT                   HNMMDLSRGCPSQRHSSTHRITGSKETRSRNERCLA"
     MACTELLAGG LPQNASLDEI NTLVYRYSPA DCSAIELVGG ADEHTAALIA INGANVTALN        60
     PALNPALNPI RRRPCEPACK PFSPTPRCTS AHLLPPALTL PPLCHNMMDL SRGCPSQRHS       120
     STHRITGSKE TRSRNERCLA                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page