(data stored in ACNUC29543 zone)

EMBL: CP001044.PE558

CP001044.PE558       Location/Qualifiers
FT   CDS             complement(640008..640859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3692"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3692"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72827"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN3"
FT                   /protein_id="ACC72827.1"
FT                   /translation="MQVLNPVLASANRVLSAVGVALCVALASSGGTVVYAASTAAHKAS
FT                   EPKASNETQGAQQTQQASAASTPDRFTADDPVKVRDMFASQISTGETHSLTERIRKLAR
FT                   EPYDRFVHGRAATAGNAQRTFLFMIPAPHGILYRSSTHMLSVNVPLASDDDPDVIQLYQ
FT                   SIEGPRGRGLVIAPDAKAKGFIQKIDSIELATAGKKTTARGRLKLPQASFEQADDNFAI
FT                   VLVCTLEPPYLTETREHSDPTDEEPTDITRRTSTLHANVQAVWLVNKKDNTVLAKGLHL
FT                   AK"
     MQVLNPVLAS ANRVLSAVGV ALCVALASSG GTVVYAASTA AHKASEPKAS NETQGAQQTQ        60
     QASAASTPDR FTADDPVKVR DMFASQISTG ETHSLTERIR KLAREPYDRF VHGRAATAGN       120
     AQRTFLFMIP APHGILYRSS THMLSVNVPL ASDDDPDVIQ LYQSIEGPRG RGLVIAPDAK       180
     AKGFIQKIDS IELATAGKKT TARGRLKLPQ ASFEQADDNF AIVLVCTLEP PYLTETREHS       240
     DPTDEEPTDI TRRTSTLHAN VQAVWLVNKK DNTVLAKGLH LAK                         283
//

If you have problems or comments...

PBIL Back to PBIL home page