(data stored in ACNUC29543 zone)

EMBL: CP001044.PE56

CP001044.PE56        Location/Qualifiers
FT   CDS             64552..65856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3157"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   bxe:Bxe_B1656 CobB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3157"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72325"
FT                   /db_xref="GOA:B2JRJ8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ8"
FT                   /protein_id="ACC72325.1"
FT                   /translation="MPACPALFISAPASGQGKTTVTAALARHHRRMGRDVRVFKTGPDF
FT                   LDPMILARASGASVMSLDLWMVGEHACRALLAEAARNADLILIEGVMGLFDGTPSSADL
FT                   AAKFDVPVAAVISAKAMAQTFGAVAFGLARFRPDVPFHGVFANRVGSARHAQMLEESLP
FT                   AGLTMLGYLSSTDAIELPDRHLGLLQAAEIGDLDARLDRAAEALASTALAQLPPVVAFD
FT                   EPAQEATLPRLLDGMHIAIARDAAFAFIYPANVQLLEALGARVTYFSPLADEPVPVDAS
FT                   ALYLPGGYPELHALALAANARSAASVRAHAAANKTIVAECGGMLYLLDSVTDTQGITTP
FT                   MLGLLPGHAAMQTRFAALGMQQVDDSLHGTLTGHTFHYSRVSTPLAPVRHATRAQSDAP
FT                   GEAVYRQGSIVATYMHGYWPSNPAFAAALFNGRAF"
     MPACPALFIS APASGQGKTT VTAALARHHR RMGRDVRVFK TGPDFLDPMI LARASGASVM        60
     SLDLWMVGEH ACRALLAEAA RNADLILIEG VMGLFDGTPS SADLAAKFDV PVAAVISAKA       120
     MAQTFGAVAF GLARFRPDVP FHGVFANRVG SARHAQMLEE SLPAGLTMLG YLSSTDAIEL       180
     PDRHLGLLQA AEIGDLDARL DRAAEALAST ALAQLPPVVA FDEPAQEATL PRLLDGMHIA       240
     IARDAAFAFI YPANVQLLEA LGARVTYFSP LADEPVPVDA SALYLPGGYP ELHALALAAN       300
     ARSAASVRAH AAANKTIVAE CGGMLYLLDS VTDTQGITTP MLGLLPGHAA MQTRFAALGM       360
     QQVDDSLHGT LTGHTFHYSR VSTPLAPVRH ATRAQSDAPG EAVYRQGSIV ATYMHGYWPS       420
     NPAFAAALFN GRAF                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page