(data stored in ACNUC29543 zone)

EMBL: CP001044.PE562

CP001044.PE562       Location/Qualifiers
FT   CDS             complement(645767..646657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3696"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: sde:Sde_3214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3696"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72831"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN7"
FT                   /protein_id="ACC72831.1"
FT                   /translation="MQTLECVLPAAAALGECPRWDERRAKLWWVDIQAPALHAFDPKTG
FT                   QDTMLPMPENIGCFSLTEDDGFIAGMRTGIFLLDAKGQVVRKLCANPENPATSRFNDGR
FT                   CDAHGRFWLGTLDEPKAGNAAALYCYGNGALTKVDAGLLTSNGMAFSPDYRWCYHSDTP
FT                   RFTIYRHSYDVDSGEVGPREEWVKFEPTPTDRGRPDGASVDSEGFYWAALYEGGRVVRI
FT                   SPDGKVVETHPLAARCPTMCTFGGDDLRTLYVTTARQGRSAEELEQYPQSGAVFAMRVS
FT                   VPGLIEKRSALRVAD"
     MQTLECVLPA AAALGECPRW DERRAKLWWV DIQAPALHAF DPKTGQDTML PMPENIGCFS        60
     LTEDDGFIAG MRTGIFLLDA KGQVVRKLCA NPENPATSRF NDGRCDAHGR FWLGTLDEPK       120
     AGNAAALYCY GNGALTKVDA GLLTSNGMAF SPDYRWCYHS DTPRFTIYRH SYDVDSGEVG       180
     PREEWVKFEP TPTDRGRPDG ASVDSEGFYW AALYEGGRVV RISPDGKVVE THPLAARCPT       240
     MCTFGGDDLR TLYVTTARQG RSAEELEQYP QSGAVFAMRV SVPGLIEKRS ALRVAD           296
//

If you have problems or comments...

PBIL Back to PBIL home page