(data stored in ACNUC29543 zone)

EMBL: CP001044.PE564

CP001044.PE564       Location/Qualifiers
FT   CDS             complement(647825..648433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3698"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bur:Bcep18194_B1304 CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72833"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN9"
FT                   /protein_id="ACC72833.1"
FT                   /translation="MSISSVLHWCFGAQQHVGRDHGRSDGTDSPDDAERCSPQDERRAL
FT                   LGELQRQAYLHELLRLTCADVMRTPPVTVSVDETIGGALKTLDAHHIKLLPVVDTHGRL
FT                   KGVVTHVDLQPLDEVLPFLKLASDTTAPESERREWPVTTVMSAHVRYVDVLTPLTEIIP
FT                   LFTTNGHHHLPVVEEGGRVVGMLTQADILKLMCGRPGGI"
     MSISSVLHWC FGAQQHVGRD HGRSDGTDSP DDAERCSPQD ERRALLGELQ RQAYLHELLR        60
     LTCADVMRTP PVTVSVDETI GGALKTLDAH HIKLLPVVDT HGRLKGVVTH VDLQPLDEVL       120
     PFLKLASDTT APESERREWP VTTVMSAHVR YVDVLTPLTE IIPLFTTNGH HHLPVVEEGG       180
     RVVGMLTQAD ILKLMCGRPG GI                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page