(data stored in ACNUC29543 zone)

EMBL: CP001044.PE565

CP001044.PE565       Location/Qualifiers
FT   CDS             648623..649723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3699"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /note="TIGRFAM: tRNA 2-selenouridine synthase; SMART:
FT                   Rhodanese domain protein; KEGG: bte:BTH_I0620 YbbB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3699"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72834"
FT                   /db_xref="GOA:B2JMP0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP0"
FT                   /protein_id="ACC72834.1"
FT                   /translation="MHAIIELTSRRDRSLLLPLKSLLAPLDQIADFDEIVDVRTPLEFA
FT                   EDHIPGAINAPVLSNEERVIIGTMYKQVSPFEATRQGAAMVSRNIAAHLETTFADRPRN
FT                   WRPLVYCWRGGKRSGSMTTWFNLIGWRARQLDGGYKTYRRSVVELLETLPQQFRYIVLA
FT                   GHTGSGKTRLLNALAGADAQTLDLEALAAHRGSILGMLPDEAQPSQKAFDTALIGALRG
FT                   FDANQPVFVEAESRRIGAIALPVSLTEQIHRGTCIRVETERDERIRLLLQDYAHLFDNR
FT                   ALFKSQLARLVELHGHARIEEWHKLIDEDRRVELFEQLIDLHYDPAYARSTGKHFAKLP
FT                   ESTHFVLRPTDADLHEQACALLARLR"
     MHAIIELTSR RDRSLLLPLK SLLAPLDQIA DFDEIVDVRT PLEFAEDHIP GAINAPVLSN        60
     EERVIIGTMY KQVSPFEATR QGAAMVSRNI AAHLETTFAD RPRNWRPLVY CWRGGKRSGS       120
     MTTWFNLIGW RARQLDGGYK TYRRSVVELL ETLPQQFRYI VLAGHTGSGK TRLLNALAGA       180
     DAQTLDLEAL AAHRGSILGM LPDEAQPSQK AFDTALIGAL RGFDANQPVF VEAESRRIGA       240
     IALPVSLTEQ IHRGTCIRVE TERDERIRLL LQDYAHLFDN RALFKSQLAR LVELHGHARI       300
     EEWHKLIDED RRVELFEQLI DLHYDPAYAR STGKHFAKLP ESTHFVLRPT DADLHEQACA       360
     LLARLR                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page