(data stored in ACNUC29543 zone)

EMBL: CP001044.PE566

CP001044.PE566       Location/Qualifiers
FT   CDS             complement(649764..652106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3700"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: bxe:Bxe_B2035
FT                   putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3700"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72835"
FT                   /db_xref="GOA:B2JMP1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP1"
FT                   /protein_id="ACC72835.1"
FT                   /translation="MLFSPTEQTSDAGFRSRFHRRSLEHQRPLSTVTMAFTVVAFIIFV
FT                   CARSLVAGPAVPLVWRLACALVLALLVAAIPRTRRIWVFGGIGVAYTLVLLAGLAVNVA
FT                   GLDEPLLWALPAIVVVSVCAAPLWLTPAHFCIGTALFYAAGTPFLLSLPHPHGDVSVVC
FT                   WMWVLIALPTAAVFHFGFYGLRRNHFLLEDRLARLAATDPLTGLQNRRAFLEQAALRLS
FT                   SLDPGAKTSAIFLDIDYFKSLNDQFGHAVGDQALSDVARVLKEMTGAGDIVSRIGGEEF
FT                   ALLHGAALRPAVQLAETLRAAIGRIARPDGQLGASFGVAEYRPGESVMALLDRADEALL
FT                   RAKYSGRNRVCAERATLVDPVRLARTHDDADGAASQPVRQQWDDFWLTSHFQPLYSLSH
FT                   QKQVGFEALLRGEREDGAQVPPAVLFSPKPFTDQGELDRVSHALHLGNARRLIPDDAWV
FT                   FLNILPSTFVADGYPDQLAQIARSAGISAGRVVLELLESHGGSVDEMSRVASQYRDHGF
FT                   LIAVDDFGAGHSNLDRLLRIRPDLVKLDGELIRAKSHGADQPILPKLVSLLHQAGMLVV
FT                   VEGVETTEQLILAVESNVDFAQGFLLGRPAPSITPPDAVHRRIDHAFDVIAEGRAHQHA
FT                   LFESEVRPYRQALDAGVDAWLKGTPLKDAFYDLAQLELCISCFVLDDAGRQIGHELPGK
FT                   ASAIDGGSLHPVANPRDARWDHRPYFRNAVLKPGVPITSSPYLSLASGRPCIAVTVALQ
FT                   SEGGRCVVGAELDWSLQRLPWPTAEHW"
     MLFSPTEQTS DAGFRSRFHR RSLEHQRPLS TVTMAFTVVA FIIFVCARSL VAGPAVPLVW        60
     RLACALVLAL LVAAIPRTRR IWVFGGIGVA YTLVLLAGLA VNVAGLDEPL LWALPAIVVV       120
     SVCAAPLWLT PAHFCIGTAL FYAAGTPFLL SLPHPHGDVS VVCWMWVLIA LPTAAVFHFG       180
     FYGLRRNHFL LEDRLARLAA TDPLTGLQNR RAFLEQAALR LSSLDPGAKT SAIFLDIDYF       240
     KSLNDQFGHA VGDQALSDVA RVLKEMTGAG DIVSRIGGEE FALLHGAALR PAVQLAETLR       300
     AAIGRIARPD GQLGASFGVA EYRPGESVMA LLDRADEALL RAKYSGRNRV CAERATLVDP       360
     VRLARTHDDA DGAASQPVRQ QWDDFWLTSH FQPLYSLSHQ KQVGFEALLR GEREDGAQVP       420
     PAVLFSPKPF TDQGELDRVS HALHLGNARR LIPDDAWVFL NILPSTFVAD GYPDQLAQIA       480
     RSAGISAGRV VLELLESHGG SVDEMSRVAS QYRDHGFLIA VDDFGAGHSN LDRLLRIRPD       540
     LVKLDGELIR AKSHGADQPI LPKLVSLLHQ AGMLVVVEGV ETTEQLILAV ESNVDFAQGF       600
     LLGRPAPSIT PPDAVHRRID HAFDVIAEGR AHQHALFESE VRPYRQALDA GVDAWLKGTP       660
     LKDAFYDLAQ LELCISCFVL DDAGRQIGHE LPGKASAIDG GSLHPVANPR DARWDHRPYF       720
     RNAVLKPGVP ITSSPYLSLA SGRPCIAVTV ALQSEGGRCV VGAELDWSLQ RLPWPTAEHW       780
//

If you have problems or comments...

PBIL Back to PBIL home page