(data stored in ACNUC29543 zone)

EMBL: CP001044.PE568

CP001044.PE568       Location/Qualifiers
FT   CDS             653353..653973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3702"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72837"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP3"
FT                   /protein_id="ACC72837.1"
FT                   /translation="MKLNRTMLAALGLLAMSSAHATSFNCAIAHSTAETLICHDAGLSK
FT                   ADDELGKLFRLALKQTADRRAYRRDSDSKWTWREENCKDVACLTDWYSTRIGEIREHLR
FT                   KPAPGEEQARPVDSDLAAVSKPSAKRKAFESQAFARDVQQCTATTQDLVPPVQCSSVLE
FT                   KHAQWQTHGPATDGWFCGVAMIAPPPTDGGARKQAPNVLSESF"
     MKLNRTMLAA LGLLAMSSAH ATSFNCAIAH STAETLICHD AGLSKADDEL GKLFRLALKQ        60
     TADRRAYRRD SDSKWTWREE NCKDVACLTD WYSTRIGEIR EHLRKPAPGE EQARPVDSDL       120
     AAVSKPSAKR KAFESQAFAR DVQQCTATTQ DLVPPVQCSS VLEKHAQWQT HGPATDGWFC       180
     GVAMIAPPPT DGGARKQAPN VLSESF                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page